A8908
SNRPB2 Rabbit polyclonal antibody
Größe
£151.00
- SKU:
- A8908
- Zusätzliche Namen:
- Msl1|SNRPB2|U2B''
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 30kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MDIRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQAFVIFKELGSSTNALRQLQGFPFYGKPMRIQYAKTDSDIISKMRGTFADKEKKKEKKKAKTVEQTATTTNKKPGQGTPNSANTQGNSTPNPQVPDYPPN
- Uniprot:
- P08579
- Synonyme:
- Msl1;small nuclear ribonucleoprotein polypeptide B;U2 small nuclear ribonucleoprotein B'';U2 snRNP B'';U2B''
- Weitere Details:
- The protein encoded by this gene associates with stem loop IV of U2 small nuclear ribonucleoprotein (U2 snRNP) in the presence of snRNP-A'. The encoded protein may play a role in pre-mRNA splicing. Autoantibodies from patients with systemic lupus erythematosus frequently recognize epitopes on the encoded protein. Two transcript variants encoding the same protein have been found for this gene.
- Versandbedingungen:
- Blue Ice