HDAC8 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A8865
Zusätzliche Namen:: C8|CDA07|CDLS5|HD8|HDACL1|KDAC8|MRXS6|RPD3|WTS
Anwendung:: ELISA, IHC-P, IF, ICC, IP
Molekulargewicht:: 42kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MEEPEEPADSGQSLVPVYIYSPEYVSMCDSLAKIPKRASMVHSLIEAYALHKQMRIVKPKVASMEEMATFHTDAYLQHLQKVSQEGDDDHPDSIEYGLGY
Uniprot:: Q9BY41
Synonyme:: CDA07;CDLS5;HD8;HDACL1;histone deacetylase 8;histone deacetylase-like 1;KDAC8;MRXS6;RPD3;WTS
Weitere Details:: Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to class I of the histone deacetylase family. It catalyzes the deacetylation of lysine residues in the histone N-terminal tails and represses transcription in large multiprotein complexes with transcriptional co-repressors. Multiple transcript variants encoding different isoforms have been found for this gene.