HDGFRP3 Rabbit polyclonal antibody

Größe

£151.00

SKU:: A8815
Zusätzliche Namen:: CGI-142|HDGF-2|HDGF2|HDGFRP3|HRP-3
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 28kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: NNPGVKFTGYQAIQQQSSSETEGEGGNTADASSEEEGDRVEEDGKGKRKNEKAGSKRKKSYTSKKSSKQSRKSPGDEDDKDCKEEENKSSSEGGDAGNDTRNTTSDLQKTSEGT
Synonyme:: CGI-142;HDGF-2;HDGF2;HDGFRP3;hepatoma-derived growth factor 2;hepatoma-derived growth factor-related protein 3;hepatoma-derived growth factor, related protein 3;HRP-3
Weitere Details:: Predicted to enable double-stranded DNA binding activity; microtubule binding activity; and transcription coregulator activity. Predicted to be involved in several processes, including microtubule polymerization; negative regulation of microtubule depolymerization; and neuron projection development. Located in nucleoplasm.