A8805
FNTA Rabbit polyclonal antibody
Größe
£151.00
- SKU:
- A8805
- Zusätzliche Namen:
- FNTA|FPTA|PGGT1A|PTAR2
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 44kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- LKGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSTENDSPTNVQQ
- Uniprot:
- P49354
- Synonyme:
- CAAX farnesyltransferase subunit alpha;farnesyl-protein transferase alpha-subunit;FPTA;FTase-alpha;GGTase-I-alpha;PGGT1A;protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha;protein prenyltransferase alpha subunit repeat containing 2;PTAR2;ras proteins prenyltransferase subunit alpha;type I protein geranyl-geranyltransferase alpha subunit;Type I protein geranyl-geranyltransferase subunit alpha
- Weitere Details:
- Prenyltransferases can attach either a farnesyl group or a geranylgeranyl group in thioether linkage to the cysteine residue of proteins with a C-terminal CAAX box. CAAX geranylgeranyltransferase and CAAX farnesyltransferase are heterodimers that share the same alpha subunit but have different beta subunits. This gene encodes the alpha subunit of these transferases. Alternative splicing results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 11 and 13.
- Versandbedingungen:
- Blue Ice