A8802
NME1/NM23A Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A8802
- Zusätzliche Namen:
- AWD|GAAD|NB|NBS|NDKA|NDPK-A|NDPKA|NM23|NM23-H1|NME1/NM23A
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 16 kDa/18 kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSK
- Uniprot:
- P15531
- Synonyme:
- AWD;epididymis secretory sperm binding protein;GAAD;granzyme A-activated DNase;metastasis inhibition factor nm23;NB;NBS;NDKA;NDP kinase A;NDPK-A;NDPKA;NM23;NM23-H1;non-metastatic cells 1, protein (NM23A) expressed in;nucleoside diphosphate kinase A;tumor metastatic process-associated protein
- Weitere Details:
- This gene (NME1) was identified because of its reduced mRNA transcript levels in highly metastatic cells. Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of 'A' (encoded by this gene) and 'B' (encoded by NME2) isoforms. Mutations in this gene have been identified in aggressive neuroblastomas. Two transcript variants encoding different isoforms have been found for this gene. Co-transcription of this gene and the neighboring downstream gene (NME2) generates naturally-occurring transcripts (NME1-NME2), which encodes a fusion protein comprised of sequence sharing identity with each individual gene product.
- Versandbedingungen:
- Blue Ice