A8801
Endo G Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A8801
- Zusätzliche Namen:
- Endo G|ENDOG|endonuclease G
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 33kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- GPLFLPRTEADGKSYVKYQVIGKNHVAVPTHFFKVLILEAAGGQIELRTYVMPNAPVDEAIPLERFLVPIESIERASGLLFVPNILARAGSLKAITAGSK
- Uniprot:
- Q14249
- Synonyme:
- endo G;endonuclease G, mitochondrial;mitochondrial endonuclease G
- Weitere Details:
- The protein encoded by this gene is a nuclear encoded endonuclease that is localized in the mitochondrion. The encoded protein is widely distributed among animals and cleaves DNA at GC tracts. This protein is capable of generating the RNA primers required by DNA polymerase gamma to initiate replication of mitochondrial DNA.
- Versandbedingungen:
- Blue Ice