Complement factor H Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A8798
Zusätzliche Namen:: AHUS1|AMBP1|ARMD4|ARMS1|CFHL3|Complement factor H|FH|FHL1|HF|HF1|HF2|HUS
Anwendung:: ELISA, WB
Molekulargewicht:: 139kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: GGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSK
Uniprot:: P08603
Synonyme:: adrenomedullin binding protein;age-related maculopathy susceptibility 1;AHUS1;AMBP1;ARMD4;ARMS1;beta-1-H-globulin;beta-1H;CFHL3;complement factor H;factor H;factor H-like 1;FH;FHL1;H factor 1;H factor 1 (complement);H factor 2 (complement);HF;HF1;HF2;HUS
Weitere Details:: This gene is a member of the Regulator of Complement Activation (RCA) gene cluster and encodes a protein with twenty short consensus repeat (SCR) domains. This protein is secreted into the bloodstream and has an essential role in the regulation of complement activation, restricting this innate defense mechanism to microbial infections. Mutations in this gene have been associated with hemolytic-uremic syndrome (HUS) and chronic hypocomplementemic nephropathy. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.