PAR2 Rabbit polyclonal antibody

Größe

£151.00

SKU:: A8796
Zusätzliche Namen:: GPR11|PAR2
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 55kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LLAASLSCSGTIQGTSRSSKGRSLIGKVDGTSHVTGKGVTVETVFSVDEFSASVLTGKLTTVFLPIVYTIVFVVGLPSNG
Uniprot:: P55085
Synonyme:: coagulation factor II (thrombin) receptor-like 1;Coagulation factor II receptor-like 1;G-protein coupled receptor 11;GPR11;PAR2;protease-activated receptor 2;proteinase-activated receptor 2;thrombin receptor-like 1
Weitere Details:: This gene encodes a member of the G-protein coupled receptor 1 family of proteins. The encoded cell surface receptor is activated through proteolytic cleavage of its extracellular amino terminus, resulting in a new amino terminus that acts as a tethered ligand that binds to an extracellular loop domain. Activation of the receptor has been shown to stimulate vascular smooth muscle relaxation, dilate blood vessels, increase blood flow, and lower blood pressure. This protein is also important in the inflammatory response, as well as innate and adaptive immunity.