A8790
PBXIP1 Rabbit polyclonal antibody
Größe
£151.00
- SKU:
- A8790
- Zusätzliche Namen:
- HPIP|PBXIP1
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 110kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MASCPDSDNSWVLAGSESLPVETLGPASRMDPESERALQAPHSPSKTDGKELAGTMDGEGTLFQTESPQSGSILTEETEVKGTLEGDVCGVEPPGPGDTVVQGDLQETTVVTGLGPDTQDLEGQSPPQSLPSTPKAAWIREEGRCSSSDDDTDVDMEGLRRRRGREAGPPQPMVPLAVENQAGGEGAGGE
- Uniprot:
- Q96AQ6
- Synonyme:
- hematopoietic PBX-interacting protein;HPIP;pre-B-cell leukemia homeobox interacting protein 1;pre-B-cell leukemia transcription factor-interacting protein 1
- Weitere Details:
- The protein encoded by this gene interacts with the PBX1 homeodomain protein, inhibiting its transcriptional activation potential by preventing its binding to DNA. The encoded protein, which is primarily cytosolic but can shuttle to the nucleus, also can interact with estrogen receptors alpha and beta and promote the proliferation of breast cancer, brain tumors, and lung cancer. Several transcript variants encoding different isoforms have been found for this gene. More variants exist, but their full-length natures have yet to be determined.
- Versandbedingungen:
- Blue Ice