RanGAP1 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A8758
Zusätzliche Namen:: Fug1|RANGAP|RanGAP1|SD
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 68kDa/90kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MASEDIAKLAETLAKTQVAGGQLSFKGKSLKLNTAEDAKDVIKEIEDFDSLEALRLEGNTVGVEAARVIAKALEKKSELKRCHWSDMFTGRLRTEIPPAL
Uniprot:: P46060
Synonyme:: Fug1;ran GTPase-activating protein 1;RANGAP;SD;segregation distorter homolog
Weitere Details:: This gene encodes a protein that associates with the nuclear pore complex and participates in the regulation of nuclear transport. The encoded protein interacts with Ras-related nuclear protein 1 (RAN) and regulates guanosine triphosphate (GTP)-binding and exchange. Alternative splicing results in multiple transcript variants.