A8727
SIX2 Rabbit polyclonal antibody

Größe
£151.00
- SKU:
- A8727
- Zusätzliche Namen:
- SIX2
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 32kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- SIWDGEETSYCFKEKSRSVLREWYAHNPYPSPREKRELAEATGLTTTQVSNWFKN
- Uniprot:
- Q9NPC8
- Synonyme:
- homeobox protein SIX2;sine oculis homeobox homolog 2
- Weitere Details:
- This gene is a member of the vertebrate gene family which encode proteins homologous to the Drosophila 'sine oculis' homeobox protein. The encoded protein is a transcription factor which, like other members of this gene family, may be involved in limb or eye development.
- Versandbedingungen:
- Blue Ice



