PUS1 Rabbit polyclonal antibody

Größe

£151.00

SKU:: A8720
Zusätzliche Namen:: MLASA1|PUS1
Anwendung:: ELISA, WB
Molekulargewicht:: 47kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: YAPESVLERSWGTEKVDVPKAPGLGLVLERVHFEKYNQRFGNDGLHEPLDWAQEEGKVAAFKEEHIYPTIIGTERDERSMAQWLSTLPIHNFSATALTAGGTGAKVPSPLEGSEGDGDTD
Uniprot:: Q9Y606
Synonyme:: mitochondrial tRNA pseudouridine synthase A;MLASA1;pseudouridylate synthase 1;tRNA pseudouridine synthase A;tRNA pseudouridine synthase A, mitochondrial;tRNA pseudouridine(38-40) synthase;tRNA pseudouridylate synthase I;tRNA uridine isomerase I;tRNA-uridine isomerase I
Weitere Details:: This gene encodes a pseudouridine synthase that converts uridine to pseudouridine once it has been incorporated into an RNA molecule. The encoded enzyme may play an essential role in tRNA function and in stabilizing the secondary and tertiary structure of many RNAs. A mutation in this gene has been linked to mitochondrial myopathy and sideroblastic anemia. Alternate splicing results in multiple transcript variants.