Calpain 1 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A8710
Zusätzliche Namen:: Calpain 1|CANP|CANP1|CANPL1|muCANP|muCL|SPG76
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 80 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: DGATRTDICQGALGDCWLLAAIASLTLNDTLLHRVVPHGQSFQNGYAGIFHFQLWQFGEWVDVVVDDLLPIKDGKLVFVHSAEGNEFWSALLEKAYAKVNG
Uniprot:: P07384
Synonyme:: calcium-activated neutral proteinase 1;calpain 1, (mu/I) large subunit;calpain mu-type;calpain-1 catalytic subunit;calpain-1 large subunit;calpain, large polypeptide L1;CANP;CANP 1;CANP1;CANPL1;cell proliferation-inducing gene 30 protein;cell proliferation-inducing protein 30;micromolar-calpain;muCANP;muCL;SPG76
Weitere Details:: The calpains, calcium-activated neutral proteases, are nonlysosomal, intracellular cysteine proteases. The mammalian calpains include ubiquitous, stomach-specific, and muscle-specific proteins. The ubiquitous enzymes consist of heterodimers with distinct large, catalytic subunits associated with a common small, regulatory subunit. This gene encodes the large subunit of the ubiquitous enzyme, calpain 1. Several transcript variants encoding two different isoforms have been found for this gene.