FERMT2 Rabbit polyclonal antibody

Größe

£151.00

SKU:: A8709
Zusätzliche Namen:: FERMT2|KIND2|mig-2|MIG2|PLEKHC1|UNC112|UNC112B
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 78kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: KVFKPKKLTLKGYKQYWCTFKDTSISCYKSKEESSGTPAHQMNLRGCEVTPDVNISGQKFNIKLLIPVAEGMNEIWLRCDNEKQYAHWMAACRLASKGKTMADSSYNLEVQNILSFLKMQHLNPDPQLIPEQITTDITPECLVSPRYLKKYKNKQITARILEAHQNVAQMS
Uniprot:: Q96AC1
Synonyme:: fermitin family homolog 2;fermitin family member 2;KIND2;kindlin 2;Kindlin-2;mig-2;MIG2;mitogen inducible gene 2 protein;mitogen inducible gene-2;Mitogen-inducible gene 2 protein;PH domain-containing family C member 1;pleckstrin homology domain containing, family C (with FERM domain) member 1;pleckstrin homology domain containing, family C member 1;Pleckstrin homology domain-containing family C member 1;PLEKHC1;UNC112;UNC112B
Weitere Details:: Enables several functions, including actin binding activity; phosphatidylinositol-3,4,5-trisphosphate binding activity; and type I transforming growth factor beta receptor binding activity. Involved in several processes, including cell surface receptor signaling pathway; positive regulation of cell differentiation; and positive regulation of cellular component biogenesis. Acts upstream of or within cell adhesion and protein localization to cell junction. Located in cytosol; focal adhesion; and nucleoplasm. Is extrinsic component of cytoplasmic side of plasma membrane. Part of adherens junction and plasma membrane. Biomarker of acute myeloid leukemia.

Versandbedingungen:: Blue Ice