A8708
IGHA1 Rabbit polyclonal antibody
Größe
£151.00
- SKU:
- A8708
- Zusätzliche Namen:
- IgA1|IGHA1
- Anwendung:
- ELISA, Flow Cytometry, WB
- Molekulargewicht:
- 60kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- CCHPRLSLHRPALEDLLLGSEANLTCTLTGLRDASGVTFTWTPSSGKSAVQGPPERDLCGCYSVSSVLPGCAEPWNHGKTFTCTAAYPESKTPLTATLSKSGNTFRPEVHLLPPPSEELALNELVTLTCLARGFSPKDVLVRWLQGSQELPREKYLTWASRQEPSQGTTTFAVTSILRVAAEDWKKGDTFSCMVGHEALPLAFTQKTIDRLADWQMPPPYVVLDLPQETLEE
- Uniprot:
- P01876
- Synonyme:
- Ig alpha-1 chain C region;Ig alpha-1 chain C region BUR;Ig alpha-1 chain C region TRO;IgA1;immunoglobulin alpha 1;immunoglobulin heavy chain constant region alpha 1
- Weitere Details:
- Contributes to immunoglobulin receptor binding activity. Involved in antibacterial humoral response; glomerular filtration; and positive regulation of respiratory burst. Located in extracellular space. Part of monomeric IgA immunoglobulin complex and secretory dimeric IgA immunoglobulin complex.
- Versandbedingungen:
- Blue Ice