FXR1 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A8697
Zusätzliche Namen:: CMYP9A|CMYP9B|FXR1|FXR1P|MYOPMIL|MYORIBF
Anwendung:: ELISA, WB, IF, ICC, IP
Molekulargewicht:: 70-80kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MAELTVEVRGSNGAFYKGFIKDVHEDSLTVVFENNWQPERQVPFNEVRLPPPPDIKKEISEGDEVEVYSRANDQEPCGWWLAKVRMMKGEFYVIEYAACD
Uniprot:: P51114
Synonyme:: fragile X mental retardation syndrome-related protein 1;fragile X mental retardation, autosomal homolog 1;FXR1P;MYOPMIL;MYORIBF
Weitere Details:: The protein encoded by this gene is an RNA binding protein that interacts with the functionally-similar proteins FMR1 and FXR2. These proteins shuttle between the nucleus and cytoplasm and associate with polyribosomes, predominantly with the 60S ribosomal subunit. Three transcript variants encoding different isoforms have been found for this gene.