TIMM23 Rabbit polyclonal antibody

Größe

£151.00

SKU:: A8688
Zusätzliche Namen:: TIM23|TIMM23
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 22kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: SGNKTTGGLAGFFGAGGAGYSHADLAGVPLTGMNPLSPYLNVDPRYLVQDTDEFILPTGANKTRGR
Uniprot:: O14925
Synonyme:: mitochondrial import inner membrane translocase subunit Tim23;TIM23;translocase of inner mitochondrial membrane 23 homolog;translocase of the inner mitochondrial membrane
Weitere Details:: The protein encoded by this gene is part of a complex located in the inner mitochondrial membrane that mediates the transport of transit peptide-containing proteins across the membrane. Multiple transcript variants, one protein-coding and others not protein-coding, have been found for this gene.