EIF3J Rabbit polyclonal antibody

Größe

£151.00

SKU:: A8637
Zusätzliche Namen:: eIF3-alpha|eIF3-p35|EIF3J|EIF3S1
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 37kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MAAAAAAAGDSDSWDADAFSVEDPVRKVGGGGTAGGDRWEGEDEDEDVKDNWDDDDDEKKEEAEVKPEVKISEKKKIAEKIKEKERQQKKRQEEIKKRLEEPEEPKVLTPEEQLADKLRLKKLQEESDLELAKETFGVNNAVYGIDAMNPSSRDDFTEFGKLLKDKITQYEKSLYYASFLEVLVRDVCISLEIDDLKKITNSLTVLCSEKQKQEKQSKAKKKKKGVVPGGGLKATMKDDLADYGGYDGGYVQDYEDFM
Uniprot:: O75822
Synonyme:: eIF-3-alpha;eIF3 p35;eIF3-alpha;eIF3-p35;EIF3S1;Eukaryotic translation initiation factor 3 subunit 1;eukaryotic translation initiation factor 3 subunit J;eukaryotic translation initiation factor 3, subunit 1 (alpha, 35kD)
Weitere Details:: This gene encodes a core subunit of the eukaryotic initiation factor 3 complex, which participates in the initiation of translation by aiding in the recruitment of protein and mRNA components to the 40S ribosome. There are pseudogenes for this gene on chromosomes 1, 3, and 9. Alternative splicing results in multiple transcript variants encoding different isoforms.