[KO Validated] ITCH Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A8624
Zusätzliche Namen:: ADMFD|AIF4|AIP4|CH|NAPP1
Anwendung:: ELISA, WB
Molekulargewicht:: 103kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MSDSGSQLGSMGSLTMKSQLQITVISAKLKENKKNWFGPSPYVEVTVDGQSKKTEKCNNTNSPKWKQPLTVIVTPVSKLHFRVWSHQTLKSDVLLGTAAL
Uniprot:: Q96J02
Synonyme:: ADMFD;AIF4;AIP4;atrophin-1 interacting protein 4;Atrophin-1-interacting protein 4;E3 ubiquitin-protein ligase Itchy homolog;HECT-type E3 ubiquitin transferase Itchy homolog;itchy E3 ubiquitin protein ligase homolog;NAPP1;NFE2-associated polypeptide 1
Weitere Details:: This gene encodes a member of the Nedd4 family of HECT domain E3 ubiquitin ligases. HECT domain E3 ubiquitin ligases transfer ubiquitin from E2 ubiquitin-conjugating enzymes to protein substrates, thus targeting specific proteins for lysosomal degradation. The encoded protein plays a role in multiple cellular processes including erythroid and lymphoid cell differentiation and the regulation of immune responses. Mutations in this gene are a cause of syndromic multisystem autoimmune disease. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.