[KO Validated] GDI2 Rabbit polyclonal antibody

Größe

Auf Anfrage

SKU:: A8615
Zusätzliche Namen:: HEL-S-46e|I2|RABGDIB
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 51kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: QVIRVICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISFAHNVAAQGKYIAIVSTTVETKEPEKEIRPALELLEPIEQKFVSISDLLVPKDLGTESQIFISRTYDATTHFETTCDDIKNIYKRMTGSEFDFEEMKRKKNDIYGED
Uniprot:: P50395
Synonyme:: epididymis secretory sperm binding protein Li 46e;GDI-2;guanosine diphosphate dissociation inhibitor 2;HEL-S-46e;rab GDI beta;rab GDP dissociation inhibitor beta;rab GDP-dissociation inhibitor, beta;RABGDIB
Weitere Details:: GDP dissociation inhibitors are proteins that regulate the GDP-GTP exchange reaction of members of the rab family, small GTP-binding proteins of the ras superfamily, that are involved in vesicular trafficking of molecules between cellular organelles. GDIs slow the rate of dissociation of GDP from rab proteins and release GDP from membrane-bound rabs. GDI2 is ubiquitously expressed. The GDI2 gene contains many repetitive elements indicating that it may be prone to inversion/deletion rearrangements. Alternative splicing results in multiple transcript variants encoding distinct isoforms.