A8614
IKZF3 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A8614
- Zusätzliche Namen:
- AIO|AIOLOS|IKZF3|IMD84|ZNFN1A3
- Anwendung:
- ELISA, WB, IHC-P, IF, IP
- Molekulargewicht:
- 50-70 kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- IYQQNHMVLSRARNGMPLLKEVPRSYELLKPPPICPRDSVKVINKEGEVMDVYRCDHCRVLFLDYVMFTIHMGCHGFRDPFECNMCGYRSHDRYEFSSHIARGEHRALLK
- Uniprot:
- Q9UKT9
- Synonyme:
- AIO;AIOLOS;Ikaros family zinc finger protein 3;IMD84;zinc finger DNA binding protein Aiolos;zinc finger protein Aiolos;zinc finger protein, subfamily 1A, 3 (Aiolos);ZNFN1A3
- Weitere Details:
- This gene encodes a member of the Ikaros family of zinc-finger proteins. Three members of this protein family (Ikaros, Aiolos and Helios) are hematopoietic-specific transcription factors involved in the regulation of lymphocyte development. This gene product is a transcription factor that is important in the regulation of B lymphocyte proliferation and differentiation. Both Ikaros and Aiolos can participate in chromatin remodeling. Regulation of gene expression in B lymphocytes by Aiolos is complex as it appears to require the sequential formation of Ikaros homodimers, Ikaros/Aiolos heterodimers, and Aiolos homodimers. Several alternative transcripts encoding different isoforms have been described, as well as some non-protein coding variants.
- Versandbedingungen:
- Blue Ice