TRPA1 Rabbit polyclonal antibody

Größe

£151.00

SKU:: A8568
Zusätzliche Namen:: ANKTM1|FEPS|FEPS1|p120|TRPA1
Anwendung:: ELISA, WB, IHC-P, IF
Molekulargewicht:: 128kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: SPLLSIIQTFSMMLGDINYRESFLEPYLRNELAHPVLSFAQLVSFTIFVPIVLMNLLIGLAVGDIAEVQKHASLKRIAMQVELHTSLEKKLPLWFLRKVDQ
Uniprot:: O75762
Synonyme:: ANKTM1;ankyrin-like with transmembrane domains 1;Ankyrin-like with transmembrane domains protein 1;FEPS;FEPS1;transformation-sensitive protein p120;transient receptor potential cation channel subfamily A member 1;wasabi receptor
Weitere Details:: The structure of the protein encoded by this gene is highly related to both the protein ankyrin and transmembrane proteins. The specific function of this protein has not yet been determined; however, studies indicate the function may involve a role in signal transduction and growth control.