A8544
FCGRT Rabbit polyclonal antibody
Größe
£151.00
- SKU:
- A8544
- Zusätzliche Namen:
- alpha-chain|FcgammaRn|FCGRT|FCRN
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 40 kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- HLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVEL
- Uniprot:
- P55899
- Synonyme:
- alpha-chain;Fc fragment of IgG, receptor, transporter, alpha;FCRN;FcRn alpha chain;heavy chain of the major histocompatibility complex class I-like Fc receptor;IgG Fc fragment receptor transporter alpha chain;IgG receptor FcRn large subunit p51;immunoglobulin receptor, intestinal, heavy chain;major histocompatibility complex class I-like Fc receptor;neonatal Fc receptor;neonatal Fc-receptor for Ig;transmembrane alpha chain of the neonatal receptor
- Weitere Details:
- This gene encodes a receptor that binds the Fc region of monomeric immunoglobulin G. The encoded protein transfers immunoglobulin G antibodies from mother to fetus across the placenta. This protein also binds immunoglobulin G to protect the antibody from degradation. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice