A8533
CALCRL Rabbit polyclonal antibody
Größe
£151.00
- SKU:
- A8533
- Zusätzliche Namen:
- CALCRL|CGRPR|CRLR|LMPHM8
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 43kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- GIEFVLIPWRPEGKIAEEVYDYIMHILMHFQGLLVSTIFCFFNGEVQAILRRNWNQYKIQFGNSFSNSEALRSASYTVSTISDGPGYSHDCPSEHLNGKSIHDIENVLLKPENLYN
- Uniprot:
- Q16602
- Synonyme:
- calcitonin gene-related peptide type 1 receptor;calcitonin receptor-like;Calcitonin receptor-like receptor;CGRP type 1 receptor;CGRPR;CRLR;LMPHM8
- Weitere Details:
- Enables adrenomedullin binding activity; adrenomedullin receptor activity; and calcitonin gene-related peptide receptor activity. Involved in several processes, including G protein-coupled receptor signaling pathway; cellular response to sucrose stimulus; and receptor internalization. Located in endoplasmic reticulum; endosome; and lysosome. Part of CGRP receptor complex and adrenomedullin receptor complex. Colocalizes with plasma membrane. Implicated in hereditary lymphedema.
- Versandbedingungen:
- Blue Ice