ULK1 Rabbit polyclonal antibody

Größe

£151.00

SKU:: A8529
Zusätzliche Namen:: ATG1|ATG1A|hATG1|ULK1|UNC51|Unc51.1
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 150kDa/140kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: SSCDTDDFVMVPAQFPGDLVAEAPSAKPPPDSLMCSGSSLVASAGLESHGRTPSPSPPCSSSPSPSGRAGPFSSSRCGASVPIPVPTQVQNYQRIERNLQS
Uniprot:: O75385
Synonyme:: ATG1;ATG1 autophagy related 1 homolog;ATG1A;autophagy-related protein 1 homolog;hATG1;serine/threonine-protein kinase ULK1;Unc-51-like kinase 1;UNC51;Unc51.1
Weitere Details:: Enables identical protein binding activity; protein serine/threonine kinase activity; and small GTPase binding activity. Involved in several processes, including autophagosome assembly; positive regulation by symbiont of host autophagy; and protein phosphorylation. Located in autophagosome; cytosol; and phagophore assembly site membrane. Is extrinsic component of autophagosome membrane; extrinsic component of omegasome membrane; and extrinsic component of phagophore assembly site membrane. Part of Atg1/ULK1 kinase complex.