A8527
NOX1 Rabbit polyclonal antibody

Größe
£151.00
- SKU:
- A8527
- Zusätzliche Namen:
- GP91-2|MOX1|NOH-1|NOH-1L|NOH1|NOX1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 65kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- RKCAESFEMWDDRDSHCRRPKFEGHPPESWKWILAPVILYICERILRFYRSQQKVVITKVVMHPSKVLELQMNKRGFSMEVGQYIFVNCPSISLLEWHPF
- Uniprot:
- Q9Y5S8
- Synonyme:
- GP91-2;mitogenic oxidase (pyridine nucleotide-dependent superoxide-generating);mitogenic oxidase 1;MOX1;NADH/NADPH mitogenic oxidase subunit P65-MOX;NADPH oxidase 1;NADPH oxidase homolog-1;NOH-1;NOH1
- Weitere Details:
- This gene encodes a member of the NADPH oxidase family of enzymes responsible for the catalytic one-electron transfer of oxygen to generate superoxide or hydrogen peroxide. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
- Versandbedingungen:
- Blue Ice

