A8516
NAA25 Rabbit polyclonal antibody
Größe
£151.00
- SKU:
- A8516
- Zusätzliche Namen:
- C12orf30|MDM20|NAA25|NAP1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 120kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- LNHPVEPKNSEKTAENGVSSRIDILRLLLQQLEATLETGKRFIEKDIQYPFLGPVPTRMGGFFNSGCSQCQISSFYLVNDIYELDTSGLEDTMEIQERIENSFKSLLDQLKDVFSKCKGDLLEVKDGNLKTHPTLLENLVFFVETISVILWVSSYCESVLRPYKLNLQKKKKKKKETSIIMPPVFTSFQDYVTGLQTLISNVVDHIKGLETHLIALKLEELILEDTSLSPEERKFSKTVQGKVQSSYLHSLLEMGELLKKRLETTKKLKI
- Uniprot:
- Q14CX7
- Synonyme:
- C12orf30;MDM20;mitochondrial distribution and morphology 20;Mitochondrial distribution and morphology protein 20;N-alpha-acetyltransferase 25, NatB auxiliary subunit;N-terminal acetyltransferase B complex subunit MDM20;N-terminal acetyltransferase B complex subunit NAA25;NAP1;natB complex subunit MDM20;p120
- Weitere Details:
- This gene encodes the auxiliary subunit of the heteromeric N-terminal acetyltransferase B complex. This complex acetylates methionine residues that are followed by acidic or asparagine residues.
- Versandbedingungen:
- Blue Ice