SMEK1 Rabbit polyclonal antibody

Größe

£151.00

SKU:: A8500
Zusätzliche Namen:: FLFL1|KIAA2010|MSTP033|PP4R3|PP4R3A|SMEK1|smk-1|smk1
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 110kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: VQTFKGLKLRFEQQRERQDNPKLDSMRSILRNHRYRRDARTLEDEEEMWFNTDEDDMEDGEAVVSPSDKTKNDDDIMDPISKFMERKKLKESEEKEVLLKTNLSGRQSPSFKLSLSSGTKTNLTSQSSTTNLPGSPGSPGSPGSPGSPGSVPKNTSQTAAITTKGGLVGLVDYPDDDEDDDEDEDKEDTLPLSKKAKFDS
Uniprot:: Q6IN85
Synonyme:: FLFL1;KIAA2010;MSTP033;PP4R3;PP4R3A;serine/threonine-protein phosphatase 4 regulatory subunit 3A;SMEK homolog 1;SMEK homolog 1, suppressor of mek1;SMEK1;smk-1;smk1
Weitere Details:: Predicted to act upstream of or within positive regulation of gluconeogenesis and protein dephosphorylation. Located in cytosol and nuclear speck.