CEP83 Rabbit polyclonal antibody

Größe

£151.00

SKU:: A8491
Zusätzliche Namen:: CCDC41|CEP83|NPHP18|NY-REN-58
Anwendung:: ELISA, WB
Molekulargewicht:: 82kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MLIDERLRCEHHKANYQTLKAEHTRLQNEHVKLQNELKHLFNEKQTQQEKLQLLLEELRGELVEKTKDLEEMKLQILTPQKLELLRAQIQQELETPMRERFRNLDEEVEKYRAVYNKLRYEHTFLKSEFEHQKEEYARILDEGKIKYESEIARLEEDKEELRNQLLNVDLTKDSKRVEQLAREKVYLCQKLKGLEAEVAELKAEKENSEAQVENAQRIQVRQLAEMQ
Uniprot:: Q9Y592
Synonyme:: CCDC41;centrosomal protein of 83 kDa;coiled-coil domain-containing protein 41;NPHP18;NY-REN-58;NY-REN-58 antigen;renal carcinoma antigen NY-REN-58
Weitere Details:: The protein encoded by this gene is a centriolar protein involved in primary cilium assembly. Defects in this gene have been associated with infantile nephronophthisis and intellectual disability.