A8480
CDC42EP3 Rabbit polyclonal antibody

Größe
£151.00
- SKU:
- A8480
- Zusätzliche Namen:
- BORG2|CDC42EP3|CEP3|UB1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 37kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MPAKTPIYLKAANNKKGKKFKLRDILSPDMISPPLGDFRHTIHIGKEGQHDVFGDISFLQGNYELLPGNQEKAHLGQFPGHNEFFRANSTSDSVFTETPSPVLKNAISLPTIGGSQALMLPLLSPVTFNSKQESFGPAKLPRLSCEPVMEEKAQEKSSLLENGTVHQGDTSWGSSGSASQSSQGRDSHSSSLSEQYPDWPAEDMFDHPTPCELIKGKTKSEESLSDLTGSLLSLQLDLGPSLLDEVLNVMDKNK
- Uniprot:
- Q9UKI2
- Synonyme:
- binder of Rho GTPases 2;BORG2;CDC42 effector protein (Rho GTPase binding) 3;cdc42 effector protein 3;CEP3;CRIB-containing BORG2 protein;MSE55-related Cdc42-binding protein;MSE55-related protein;UB1
- Weitere Details:
- This gene encodes a member of a small family of guanosine triphosphate (GTP) metabolizing proteins that contain a CRIB (Cdc42, Rac interactive binding) domain. Members of this family of proteins act as effectors of CDC42 function. The encoded protein is involved in actin cytoskeleton re-organization during cell shape changes, including pseudopodia formation. A pseudogene of this gene is found on chromosome 19. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice

