A8470
CHRNA6 Rabbit polyclonal antibody

Größe
£151.00
- SKU:
- A8470
- Zusätzliche Namen:
- CHNRA6|CHRNA6
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 57kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- PQVLLMRWPLDKTRGTGSDAVPRGLARRPAKGKLASHGEPRHLKECFHCHKSNELATSKRRLSHQPLQWVVENSEHSPEVEDVINSVQFIA
- Uniprot:
- Q15825
- Synonyme:
- acetylcholine receptor, nicotinic, alpha 6 (neuronal);CHNRA6;cholinergic receptor, nicotinic alpha 6;cholinergic receptor, nicotinic, alpha 6 (neuronal);cholinergic receptor, nicotinic, alpha polypeptide 6;neuronal acetylcholine receptor subunit alpha-6
- Weitere Details:
- This gene encodes an alpha subunit of neuronal nicotinic acetylcholine receptors. These receptors consist of five subunits and function as ion channels involved in neurotransmission. The encoded protein is a subunit of neuronal nicotinic acetylcholine receptors that mediate dopaminergic neurotransmission and are activated by acetylcholine and exogenous nicotine. Alternatively spliced transcript variants have been observed for this gene. Single nucleotide polymorphisms in this gene have been associated with both nicotine and alcohol dependence.
- Versandbedingungen:
- Blue Ice

