A8459
TGFB1I1 Rabbit polyclonal antibody
Größe
£151.00
- SKU:
- A8459
- Zusätzliche Namen:
- ARA55|HIC-5|HIC5|TGFB1I1|TSC-5
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 50kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- VASGEQKEDQSEDKKRPSLPSSPSPGLPKASATSATLELDRLMASLSDFRVQNHLPASGPTQPPVVSSTNEGSPSPPEPTGKGSLDTMLGLLQSDLSRRGV
- Uniprot:
- O43294
- Synonyme:
- androgen receptor coactivator 55 kDa protein;androgen receptor coactivator ARA55;androgen receptor-associated protein of 55 kDa;ARA55;HIC-5;HIC5;hydrogen peroxide-inducible clone 5 protein;hydrogen peroxide-inducible clone-5;transforming growth factor beta-1-induced transcript 1 protein;TSC-5
- Weitere Details:
- This gene encodes a coactivator of the androgen receptor, a transcription factor which is activated by androgen and has a key role in male sexual differentiation. The encoded protein is thought to regulate androgen receptor activity and may have a role to play in the treatment of prostate cancer. Multiple transcript variants encoding different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice