SLCO1A2 Rabbit polyclonal antibody

Größe

£151.00

SKU:: A8452
Zusätzliche Namen:: OATP|OATP-A|OATP1A2|SLC21A3|SLCO1A2
Anwendung:: ELISA, WB
Molekulargewicht:: 74kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LLYFLSFLMTCENSSVVGINTSYEGIPQDLYVENDIFADCNVDCNCPSKIWDPVCGNNGLSYLSACLAGCETSIGTGINMVFQNCSCIQTSGNSSAVLGLCDKGPDCSLMLQYFLILSAMSSFIYSLAAIPGYMVLLRCMKSEEKSLGVGLHTFCTRVFAGIPAPIYFGALMDSTCLHWGTLKCGESGACRIYDSTTFRYIYLGLPAALRGSSFVPALIILILLRKCHLPGENASSGTELIETKVKGKENECKDIYQKSTVLKDDELKTKL
Uniprot:: P46721
Synonyme:: OATP;OATP-1;OATP-A;OATP1A2;organic anion transporting polypeptide A;organic anion-transporting polypeptide 1;SLC21A3;sodium-independent organic anion transporter;solute carrier family 21 (organic anion transporter), member 3;solute carrier family 21 member 3;solute carrier organic anion transporter family member 1A2
Weitere Details:: This gene encodes a sodium-independent transporter which mediates cellular uptake of organic ions in the liver. Its substrates include bile acids, bromosulphophthalein, and some steroidal compounds. The protein is a member of the SLC21A family of solute carriers. Alternative splicing of this gene results in multiple transcript variants.