A8437
MEIS2 Rabbit polyclonal antibody
Größe
£151.00
- SKU:
- A8437
- Zusätzliche Namen:
- CPCMR|HsT18361|MEIS2|MRG1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 50kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- AYSPEGQPMGSFVLDGQQHMGIRPAGLQSMPGDYVSQGGPMGMSMAQPSYTPPQMTPHPTQLRHGPPMHSYLPSHPHHPAMMMHGGPPTHPGMTMSAQSPTMLNSVDPNVGGQVMDIHAQ
- Uniprot:
- O14770
- Synonyme:
- CPCMR;homeobox protein Meis2;HsT18361;Meis homolog 2;Meis1-related gene 1;meis1-related protein 1;Meis1, myeloid ecotropic viral integration site 1 homolog 2;MRG1;TALE homeobox protein Meis2
- Weitere Details:
- This gene encodes a homeobox protein belonging to the TALE ('three amino acid loop extension') family of homeodomain-containing proteins. TALE homeobox proteins are highly conserved transcription regulators, and several members have been shown to be essential contributors to developmental programs. Multiple transcript variants encoding distinct isoforms have been described for this gene.
- Versandbedingungen:
- Blue Ice