A8423
GNG10 Rabbit polyclonal antibody
Größe
£151.00
- SKU:
- A8423
- Zusätzliche Namen:
- GNG10
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 14kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MSSGASASALQRLVEQLKLEAGVERIKVSQAAAELQQYCMQNACKDALLVGVPAGSNPFREPRSCALL
- Uniprot:
- P50151
- Synonyme:
- guanine nucleotide binding protein (G protein), gamma 10;guanine nucleotide binding protein 10;guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-10
- Weitere Details:
- Predicted to enable G-protein beta-subunit binding activity. Predicted to be involved in G protein-coupled receptor signaling pathway. Predicted to be located in plasma membrane. Predicted to be part of heterotrimeric G-protein complex.
- Versandbedingungen:
- Blue Ice