A8420
Glucosylceramidase beta (GBA) Rabbit polyclonal antibody
Größe
£151.00
- SKU:
- A8420
- Zusätzliche Namen:
- GBA|GCB|GLUC|Glucosylceramidase beta (GBA)
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 60kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- ARPCIPKSFGYSSVVCVCNATYCDSFDPPTFPALGTFSRYESTRSGRRMELSMGPIQANHTGTGLLLTLQPEQKFQKVKGFGGAMTDAAALNILALSPPAQNLLLKSYFSEEGIGYNIIRVPMASCDFSIRTYTYADTPDDFQLHNFSLPEEDTKLKIPLIHRALQLAQRPVSLLASPWTSPTWLKTNGAVNGKGSLKGQPGDIYHQTWAR
- Uniprot:
- P04062
- Synonyme:
- acid beta-glucosidase;alglucerase;beta-GC;beta-glucocerebrosidase;cholesterol glucosyltransferase;cholesteryl-beta-glucosidase;D-glucosyl-N-acylsphingosine glucohydrolase;GBA1;GCB;GLUC;glucocerebrosidase;glucosidase, beta, acid;glucosylceramidase-like protein;imiglucerase;lysosomal acid GCase;lysosomal acid glucosylceramidase;lysosomal glucocerebrosidase;SGTase
- Weitere Details:
- This gene encodes a lysosomal membrane protein that cleaves the beta-glucosidic linkage of glycosylceramide, an intermediate in glycolipid metabolism. Mutations in this gene cause Gaucher disease, a lysosomal storage disease characterized by an accumulation of glucocerebrosides. A related pseudogene is approximately 12 kb downstream of this gene on chromosome 1. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice