A8414
EPHA3 Rabbit polyclonal antibody
Größe
£151.00
- SKU:
- A8414
- Zusätzliche Namen:
- EK4|EPHA3|ETK|ETK1|HEK|HEK4|TYRO4
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 110kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- LAHTNYTFEIDAVNGVSELSSPPRQFAAVSITTNQAAPSPVLTIKKDRTSRNSISLSWQEPEHPNGIILDYEVKYYEKQEQETSYTILRARGTNVTISSLKPDTIYVFQIRARTAAGYGTNSRKFEFETSPDSFSISGESSQVVMI
- Uniprot:
- P29320
- Synonyme:
- EK4;EPH-like kinase 4;eph-like tyrosine kinase 1;ephrin type-A receptor 3;ETK;ETK1;HEK;HEK4;human embryo kinase 1;testicular tissue protein Li 64;TYRO4;TYRO4 protein tyrosine kinase;tyrosine-protein kinase receptor ETK1;Tyrosine-protein kinase TYRO4
- Weitere Details:
- This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. This gene encodes a protein that binds ephrin-A ligands. Two alternatively spliced transcript variants have been described for this gene.
- Versandbedingungen:
- Blue Ice