ATP7A Rabbit polyclonal antibody

Größe

£151.00

SKU:: A8399
Zusätzliche Namen:: ATP7A|DSMAX|MK|MNK|SMAX3
Anwendung:: ELISA, WB
Molekulargewicht:: 140-180 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MDPSMGVNSVTISVEGMTCNSCVWTIEQQIGKVNGVHHIKVSLEEKNATIIYDPKLQTPKTLQEAIDDMGFDAVIHNPD
Uniprot:: Q04656
Synonyme:: ATPase, Cu++ transporting, alpha polypeptide;copper pump 1;copper-transporting ATPase 1;Cu++-transporting P-type ATPase;DSMAX;Menkes disease-associated protein;MK;MNK;SMAX3
Weitere Details:: This gene encodes a transmembrane protein that functions in copper transport across membranes. This protein is localized to the trans Golgi network, where it is predicted to supply copper to copper-dependent enzymes in the secretory pathway. It relocalizes to the plasma membrane under conditions of elevated extracellular copper, and functions in the efflux of copper from cells. Mutations in this gene are associated with Menkes disease, X-linked distal spinal muscular atrophy, and occipital horn syndrome. Alternatively-spliced transcript variants have been observed.