A8357
NUP214 Rabbit polyclonal antibody

Größe
£151.00
- SKU:
- A8357
- Zusätzliche Namen:
- CAIN|CAN|IIAE9|NUP214
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 251kDa/214kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- QPDAFSSGGGSKPSYEAIPESSPPSGITSASNTTPGEPAASSSRPVAPSGTALSTTSSKLETPPSKLGELLFPSSLAGETLGSFSGLRVGQADDSTKPTN
- Uniprot:
- P35658
- Synonyme:
- 214 kDa nucleoporin;CAIN;CAN;CAN protein, putative oncogene;IIAE9;nuclear pore complex protein Nup214;nucleoporin 214kDa;Nucleoporin Nup214;Protein CAN
- Weitere Details:
- The nuclear pore complex is a massive structure that extends across the nuclear envelope, forming a gateway that regulates the flow of macromolecules between the nucleus and the cytoplasm. Nucleoporins are the main components of the nuclear pore complex in eukaryotic cells. This gene is a member of the FG-repeat-containing nucleoporins. The protein encoded by this gene is localized to the cytoplasmic face of the nuclear pore complex where it is required for proper cell cycle progression and nucleocytoplasmic transport. The 3' portion of this gene forms a fusion gene with the DEK gene on chromosome 6 in a t(6,9) translocation associated with acute myeloid leukemia and myelodysplastic syndrome. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms.
- Versandbedingungen:
- Blue Ice






