A8354
XPC Rabbit polyclonal antibody

Größe
£151.00
- SKU:
- A8354
- Zusätzliche Namen:
- p125|RAD4|XP3|XPC|XPCC
- Anwendung:
- ELISA, WB, IHC-P, IP
- Molekulargewicht:
- 130kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- GEVPYKMVKGFSNRARKARLAEPQLREENDLGLFGYWQTEEYQPPVAVDGKVPRNEFGNVYLFLPSMMPIGCVQLNLPNLHRVARKLDIDCVQAITGFDFHGGYSHPVTDGYIVCEEFKDVLLTAWENEQAVIERKEKEKKEKRALGNWKLLAKGLLIRERLKRRYGPKSEAAAPHTDAGGGLSSDEEEGTSSQAEAARILAASWPQNREDEEKQKLKGGPKKTKREKKAAASHLFPFEQL
- Uniprot:
- Q01831
- Synonyme:
- DNA repair protein complementing XP-C cells;mutant xeroderma pigmentosum group C;p125;RAD4;Xeroderma pigmentosum group C-complementing protein;xeroderma pigmentosum, complementation group C;XP3;XPCC
- Weitere Details:
- The protein encoded by this gene is a key component of the XPC complex, which plays an important role in the early steps of global genome nucleotide excision repair (NER). The encoded protein is important for damage sensing and DNA binding, and shows a preference for single-stranded DNA. Mutations in this gene or some other NER components can result in Xeroderma pigmentosum, a rare autosomal recessive disorder characterized by increased sensitivity to sunlight with the development of carcinomas at an early age. Alternatively spliced transcript variants have been found for this gene.
- Versandbedingungen:
- Blue Ice





