RPN2 Rabbit polyclonal antibody

Größe

£151.00

SKU:: A8352
Zusätzliche Namen:: RIBIIR|RPN-II|RPN2|RPNII|SWP1
Anwendung:: ELISA, WB
Molekulargewicht:: 69kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: ANTVELRVKISTEVGITNVDLSTVDKDQSIAPKTTRVTYPAKAKGTFIADSHQNFALFFQLVDVNTGAELTPHQTFVRLHNQKTGQEVVFVAEPDNKNVYKFELDTSERKIEFDSASGTYTLYLIIGDATLKNPILWNVADVVIKFPEEEAPSTVLSQNLFTPKQEIQHLFREPEKRPPTV
Uniprot:: P04844
Synonyme:: dolichyl-diphosphooligosaccharide--protein glycosyltransferase 63 kDa subunit;dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2;oligosaccharyltransferase complex subunit (non-catalytic);RIBIIR;Ribophorin II;ribophorin-2;RPN-II;RPNII;SWP1
Weitere Details:: This gene encodes a type I integral membrane protein found only in the rough endoplasmic reticulum. The encoded protein is part of an N-oligosaccharyl transferase complex that links high mannose oligosaccharides to asparagine residues found in the Asn-X-Ser/Thr consensus motif of nascent polypeptide chains. This protein is similar in sequence to the yeast oligosaccharyl transferase subunit SWP1. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.