KPNA3 Rabbit polyclonal antibody

Größe

£151.00

SKU:: A8347
Zusätzliche Namen:: hSRP1|IPOA4|KPNA3|SPG88|SRP1|SRP1gamma|SRP4
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 55kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MAENPSLENHRIKSFKNKGRDVETMRRHRNEVTVELRKNKRDEHLLKKRNVPQEESLEDSDVDADFKAQNVTLEAILQNATSDNPVVQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVKCLERDDNPSLQFEAAWALTNIASGTSAQTQAVVQSNAVPLFLRLLRSPHQNVCEQAVWALGNIIGDGPQCRDYVISLGVVKPLLSFISP
Uniprot:: O00505
Synonyme:: hSRP1;importin alpha 4;importin alpha Q2;importin alpha-3;importin subunit alpha-3;importin subunit alpha-4;IPOA4;karyopherin alpha 3 (importin alpha 4);Karyopherin subunit alpha-3;qip2;SRP1;SRP1-gamma;SRP1gamma;SRP4
Weitere Details:: The transport of molecules between the nucleus and the cytoplasm in eukaryotic cells is mediated by the nuclear pore complex (NPC), which consists of 60-100 proteins. Small molecules (up to 70 kD) can pass through the nuclear pore by nonselective diffusion while larger molecules are transported by an active process. The protein encoded by this gene belongs to the importin alpha family, and is involved in nuclear protein import.