EPHA4 Rabbit polyclonal antibody

Größe

£151.00

SKU:: A8346
Zusätzliche Namen:: EK8|EPHA4|HEK8|SEK|TYRO1
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 110kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: VTGSRVYPANEVTLLDSRSVQGELGWIASPLEGGWEEVSIMDEKNTPIRTYQVCNVMEPSQNNWLRTDWITREGAQRVYIE
Uniprot:: P54764
Synonyme:: EK8;EPH-like kinase 8;ephrin type-A receptor 4;HEK8;receptor protein-tyrosine kinase HEK8;SEK;TYRO1;TYRO1 protein tyrosine kinase;tyrosine-protein kinase receptor SEK;tyrosine-protein kinase TYRO1
Weitere Details:: This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Multiple transcript variants encoding different isoforms have been found for this gene.