UBE2D4 Rabbit polyclonal antibody

Größe

£151.00

SKU:: A8332
Zusätzliche Namen:: HBUCE1|UBE2D4
Anwendung:: ELISA, WB
Molekulargewicht:: 17kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MALKRIQKELTDLQRDPPAQCSAGPVGDDLFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPEIAHTYKADREKYNRLAREWTQKYAM
Uniprot:: Q9Y2X8
Synonyme:: E2 ubiquitin-conjugating enzyme D4;HBUCE1;ubiquitin carrier protein D4;ubiquitin conjugating enzyme E2D 4 (putative);ubiquitin-conjugating enzyme E2 D4;ubiquitin-conjugating enzyme HBUCE1;ubiquitin-protein ligase D4
Weitere Details:: Enables ubiquitin conjugating enzyme activity. Involved in protein polyubiquitination. Acts upstream of or within protein ubiquitination. Predicted to be part of ubiquitin ligase complex. Predicted to be active in nucleus.