A8327
NDUFB5 Rabbit polyclonal antibody
Größe
£151.00
- SKU:
- A8327
- Zusätzliche Namen:
- CISGDH|NDUFB5|SGDH
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 16kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- EIPEGYVPEHWEYYKHPISRWIARNFYDSPEKIYERTMAVLQIEAEKAELRVKELEVRKLMHVRGDGPWYYYETIDKELIDHSPKATPDN
- Uniprot:
- O43674
- Synonyme:
- CISGDH;complex I SGDH subunit;complex I-SGDH;NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 5, 16kDa;NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial;NADH-ubiquinone oxidoreductase SGDH subunit;SGDH
- Weitere Details:
- The protein encoded by this gene is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I). Mammalian complex I is composed of 45 different subunits. It locates at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Three transcript variants encoding different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice