A8326
NDUFA1 Rabbit polyclonal antibody
Größe
£151.00
- SKU:
- A8326
- Zusätzliche Namen:
- CI-MWFE|MC1DN12|MWFE|NDUFA1|ZNF183
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 14kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MWFEILPGLSVMGVCLLIPGLATAYIHRFTNGGKEKRVAHFGYHWSLMERDRRISGVDRYYVSKGLENID
- Uniprot:
- O15239
- Synonyme:
- CI-MWFE;complex I MWFE subunit;Complex I-MWFE;MC1DN12;MWFE;NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1, 7.5kDa;NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1;NADH-ubiquinone oxidoreductase MWFE subunit;NADH:ubiquinone oxidoreductase (complex 1);type I dehydrogenase;ZNF183
- Weitere Details:
- The human NDUFA1 gene codes for an essential component of complex I of the respiratory chain, which transfers electrons from NADH to ubiquinone. It has been noted that the N-terminal hydrophobic domain has the potential to be folded into an alpha-helix spanning the inner mitochondrial membrane with a C-terminal hydrophilic domain interacting with globular subunits of complex I. The highly conserved two-domain structure suggests that this feature is critical for the protein function and might act as an anchor for the NADH:ubiquinone oxidoreductase complex at the inner mitochondrial membrane. However, the NDUFA1 peptide is one of about 31 components of the "hydrophobic protein" (HP) fraction of complex I which is involved in proton translocation. Thus the NDUFA1 peptide may also participate in that function.
- Versandbedingungen:
- Blue Ice