IL36G Rabbit polyclonal antibody

Größe

£152.00

SKU:: A8304
Zusätzliche Namen:: IL-1F9|IL-1H1|IL-1RP2|IL1E|IL1F9|IL1H1|IL1RP2|IL36G
Anwendung:: ELISA, WB
Molekulargewicht:: 19kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MRGTPGDADGGGRAVYQSMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFIASSKRDQPIILTSELGKSYNTAFELNIND
Uniprot:: Q9NZH8
Synonyme:: IL-1 related protein 2;IL-1-epsilon;IL-1-related protein 2;IL-1F9;IL-1H1;IL-1RP2;IL1E;IL1F9;IL1H1;IL1RP2;interleukin 1-related protein 2;interleukin-1 epsilon;interleukin-1 family member 9;interleukin-1 homolog 1;interleukin-36 gamma
Weitere Details:: The protein encoded by this gene is a member of the interleukin 1 cytokine family. The activity of this cytokine is mediated by interleukin 1 receptor-like 2 (IL1RL2/IL1R-rp2), and is specifically inhibited by interleukin 1 family, member 5 (IL1F5/IL-1 delta). Interferon-gamma, tumor necrosis factor-alpha and interleukin 1, beta (IL1B) are reported to stimulate the expression of this cytokine in keratinocytes. The expression of this cytokine in keratinocytes can also be induced by a contact hypersensitivity reaction or herpes simplex virus infection. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2.

Versandbedingungen:: Blue Ice