A8247
SLC5A7 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A8247
- Zusätzliche Namen:
- CHT|CHT1|CMS20|DHMNVP|HMN7A|SLC5A7
- Anwendung:
- ELISA, WB, IF
- Molekulargewicht:
- 66-75kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- ESGTLPPKLDVFDAVVARHSEENMDKTILVKNENIKLDELALVKPRQSMTLSSTFTNKEAFLDVDSSPEGSGTEDNLQ
- Uniprot:
- Q9GZV3
- Synonyme:
- CHT;CHT1;CMS20;Hemicholinium-3-sensitive choline transporter;high affinity choline transporter 1;high affinity choline transporter; hemicholinium-3-sensitive choline transporter;HMN7A;solute carrier family 5 (sodium/choline cotransporter), member 7;Solute carrier family 5 member 7
- Weitere Details:
- This gene encodes a sodium ion- and chloride ion-dependent high-affinity transporter that mediates choline uptake for acetylcholine synthesis in cholinergic neurons. The protein transports choline from the extracellular space into presynaptic terminals for synthesis into acetylcholine. Increased choline uptake results from increased density of this protein in synaptosomal plasma membranes in response to depolarization of cholinergic terminals. Dysfunction of cholinergic signaling has been implicated in various disorders including depression, attention-deficit disorder, and schizophrenia. An allelic variant of this gene is associated with autosomal dominant distal hereditary motor neuronopathy type VIIA. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice