A8239
CHMP1B Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A8239
- Zusätzliche Namen:
- C10orf2|C18-ORF2|C18orf2|CHMP1.5|CHMP1B|hVps46-2|Vps46-2|Vps46B
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 30kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MSNMEKHLFNLKFAAKELSRSAKKCDKEEKAEKAKIKKAIQKGNMEVARIHAENAIRQKNQAVNFLRMSARVDAVAARVQTAVTMGKVTKSMAGVVKSMDATLKTMNLEKISALMDKFEHQFETLDVQTQQMEDTMSSTTTLTTPQNQVDMLLQEMADEAGLDLNMELPQGQTGSVGTSVASAEQDELSQRLARLRDQV
- Uniprot:
- Q7LBR1
- Synonyme:
- C10orf2;C18-ORF2;C18orf2;charged multivesicular body protein 1b;CHMP1.5;chromatin modifying protein 1B;chromatin-modifying protein 1b;hVps46-2;vacuolar protein sorting 46-2;vacuolar protein sorting-associated protein 46-2;Vps46-2;Vps46B
- Weitere Details:
- CHMP1B belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. These proteins are components of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in degradation of surface receptor proteins and formation of endocytic multivesicular bodies (MVBs). Some CHMPs have both nuclear and cytoplasmic/vesicular distributions, and one such CHMP, CHMP1A (MIM 164010), is required for both MVB formation and regulation of cell cycle progression (Tsang et al., 2006 [PubMed 16730941]).
- Versandbedingungen:
- Blue Ice

