CHMP1B Rabbit polyclonal antibody

Größe

£152.00

SKU:: A8239
Zusätzliche Namen:: C10orf2|C18-ORF2|C18orf2|CHMP1.5|CHMP1B|hVps46-2|Vps46-2|Vps46B
Anwendung:: ELISA, WB
Molekulargewicht:: 30kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MSNMEKHLFNLKFAAKELSRSAKKCDKEEKAEKAKIKKAIQKGNMEVARIHAENAIRQKNQAVNFLRMSARVDAVAARVQTAVTMGKVTKSMAGVVKSMDATLKTMNLEKISALMDKFEHQFETLDVQTQQMEDTMSSTTTLTTPQNQVDMLLQEMADEAGLDLNMELPQGQTGSVGTSVASAEQDELSQRLARLRDQV
Uniprot:: Q7LBR1
Synonyme:: C10orf2;C18-ORF2;C18orf2;charged multivesicular body protein 1b;CHMP1.5;chromatin modifying protein 1B;chromatin-modifying protein 1b;hVps46-2;vacuolar protein sorting 46-2;vacuolar protein sorting-associated protein 46-2;Vps46-2;Vps46B
Weitere Details:: CHMP1B belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. These proteins are components of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in degradation of surface receptor proteins and formation of endocytic multivesicular bodies (MVBs). Some CHMPs have both nuclear and cytoplasmic/vesicular distributions, and one such CHMP, CHMP1A (MIM 164010), is required for both MVB formation and regulation of cell cycle progression (Tsang et al., 2006 [PubMed 16730941]).

Versandbedingungen:: Blue Ice