A8207
IL36A Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A8207
- Zusätzliche Namen:
- FIL1|FIL1(EPSILON)|FIL1E|IL-1F6|IL1(EPSILON)|IL1F6|IL36A
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 23kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MEKALKIDTPQQGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYLGLNGLNLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLILTQELGKANTTDFGLTMLF
- Uniprot:
- Q9UHA7
- Synonyme:
- FIL1;FIL1 epsilon;FIL1(EPSILON);FIL1E;IL-1 epsilon;IL-1F6;IL-1F6 (FIL-1-epsilon);IL1(EPSILON);IL1F6;interleukin 1 family, member 6 (epsilon);interleukin-1 epsilon;interleukin-1 family member 6;interleukin-36 alpha
- Weitere Details:
- The protein encoded by this gene is a cytokine that can activate NF-kappa-B and MAPK signaling pathways to generate an inflammatory response. The encoded protein functions primarily in skin and demonstrates increased expression in psoriasis. In addition, decreased expression of this gene has been linked to a poor prognosis in both hepatocellular carcinoma and colorectal cancer patients.
- Versandbedingungen:
- Blue Ice

