IL36A Rabbit polyclonal antibody

Größe

£152.00

SKU:: A8207
Zusätzliche Namen:: FIL1|FIL1(EPSILON)|FIL1E|IL-1F6|IL1(EPSILON)|IL1F6|IL36A
Anwendung:: ELISA, WB
Molekulargewicht:: 23kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MEKALKIDTPQQGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYLGLNGLNLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLILTQELGKANTTDFGLTMLF
Uniprot:: Q9UHA7
Synonyme:: FIL1;FIL1 epsilon;FIL1(EPSILON);FIL1E;IL-1 epsilon;IL-1F6;IL-1F6 (FIL-1-epsilon);IL1(EPSILON);IL1F6;interleukin 1 family, member 6 (epsilon);interleukin-1 epsilon;interleukin-1 family member 6;interleukin-36 alpha
Weitere Details:: The protein encoded by this gene is a cytokine that can activate NF-kappa-B and MAPK signaling pathways to generate an inflammatory response. The encoded protein functions primarily in skin and demonstrates increased expression in psoriasis. In addition, decreased expression of this gene has been linked to a poor prognosis in both hepatocellular carcinoma and colorectal cancer patients.